My point exactly. Protamines and histones are obviously related, as you can see from the sequence fragments here. In addition, we know that protamines can serve as functional alternatives to histones - Nature, 403, 261-263(2000). Or are you still chasing poor Fred and his absolute, 100%, no-way-in-hell impossibility theory?
Sorry, Hoyle loses.
Nope! This was your point exactly ---homologs such as the protamines may well have served some entirely different function before doing what histones do now. A minor change to that homolog, and presto - histones
Plus, this
AKAKKSPRKKAAVKKSTKSKAKKPKSPKKKAAKKTARKSPKKKARKSPKKKAAKKSKK
is not obviously related to this
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Especially with a minor change qualification. Evidence follows.
Sequence 1: lcl|seq_1
Length = 58
Sequence 2: lcl|seq_2
Length = 82
No significant similarity was found
CPU time: 0.01 user secs. 0.00 sys. secs 0.01 total secs. Lambda K H 0.290 0.103 0.249 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 29 Number of extensions: 23 Number of sequences better than 10.0: 0 Number of HSP's gapped: 0 Number of HSP's successfully gapped: 0 Length of query: 58 Length of database: 1,122,496,163 Length adjustment: 33 Effective length of query: 25 Effective length of database: 1,122,496,130 Effective search space: 28062403250 Effective search space used: 28062403250 Neighboring words threshold: 9 X1: 17 ( 7.1 bits) X2: 129 (49.7 bits) X3: 129 (49.7 bits) S1: 44 (21.7 bits) S2: 70 (31.6 bits)